PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013604238.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family MYB_related
Protein Properties Length: 1644aa    MW: 180857 Da    PI: 7.1813
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013604238.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding315.7e-10856897346
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      +WT eE e ++   +++G++ +k+Ia+ +   +t  +c+++++k
   XP_013604238.1 856 PWTSEEKETFLSMLAMHGKD-FKKIASFFT-QKTTADCIDYYYK 897
                      8*****************99.********9.9**********98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466894.11E-14839900IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.1E-6848899IPR009057Homeodomain-like
PROSITE profilePS5129314.781852903IPR017884SANT domain
SMARTSM007171.3E-8853901IPR001005SANT/Myb domain
PfamPF002493.2E-8855897IPR001005SANT/Myb domain
CDDcd001674.08E-7856898No hitNo description
PROSITE profilePS5129310.83210661117IPR017884SANT domain
SMARTSM007172.0E-510671115IPR001005SANT/Myb domain
SuperFamilySSF466896.16E-810701117IPR009057Homeodomain-like
CDDcd001675.61E-510711112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1644 aa     Download sequence    Send to blast
MPPQDHSSWD RKDLLRQRKH ERPSEPPFDP PPFRWRDSPS SSSSSSHREF SRWGGSADFR  60
RPSSHGKQGG RYQFVEESSH GYTSSRSSAR MFENDYYRPS APRGDWRYTR NCRDDRVPLS  120
QKDWRSNTWE MNNGSYRAFD RPCGVRNGRR SVEERPPPAS DTHTTVVNSW EQPNSAQQMD  180
IELCTPIRTV RSKNEQKFLD QRQSLPSDPH SDGLGLFDRP SSVNSYENKE CSPAKQSNGL  240
MRGRRLADDN SLDPPILNAE IEGTRNQILL KDMHDNKLHG VSDLDGVREN GKENSLGATG  300
KLPMWTRSGS FASQSSGFSH SSSLKSLGAV DSSDGKHKIL PKTVAVTQSS SEDATACAKT  360
TVSEEMSSRK KQRLGWGEGL AKYENKKVDV NTTEDGTDLL ENSAEEIHSL NKNIADKSPT  420
AANAPDYASP TTPSSVACNS SPDKSSAKAA IGASDVSNMC RSPSPVSSIH LERLPINIEE  480
LDNISMERVG CLLNELLGTD DPGTGDSSSV QLTSMKKLLV WKGDILKAVE MAESEIDLLE  540
SKQRALKLEC GRQCRVVGPS SDLPEGDENV QQEASCVLGL KAVAFSVAQT LVRDTVHQAV  600
SAKVPVRIIE DSCREVNALP QFLATVGSNE DILPIPSTKA DSNQETVDLS SADDSMVSDE  660
DLLCAKLLST NKIYASESSQ VFNKLLPRDF SSFDESRLPG RCQRQFDSHV KEKIAERIEV  720
LRAREKILLL QFKAFQLAWK KDVRQLASAK YQSKANKKTE VFPYAKNGAH LKLSQPVRLR  780
LSSSAQRRDS VASTTELVSY MKKLLKNTRL KPFRDILRMP AMILDEKERV RSRFISSNGL  840
IEDPCDVEKE RTMINPWTSE EKETFLSMLA MHGKDFKKIA SFFTQKTTAD CIDYYYKNHK  900
SDCFAKIKKQ RSFGKEGKHT YMLAPTKKWK REMGAASLDI LGAVSIIAAN AGKVASTRQT  960
SSKRITLRGC SSSNSLQRDG NYSEGYSHSF DFPRKRTLGA DVVAVGPLSS EQINSCLRTS  1020
VNSREGCMDH LKFAPAAKKP RISHTTHNEN SNEDDDSCSE ESCGETGPIH WTDAERSAFI  1080
QGFSLFGKNF ASLSRFVRTR SPDQCRVFFS KVRKCLGLEC IQSGSRNVSA SASVDNANEG  1140
GGSDLDGPCA TESNSGICNN GVSSKIGLNT LTSPLNMNQE GANHSGFENV EAGLSRSEQE  1200
NGLALLRLKD GTNLVNTANI NGDSEPCRDL VDINTVESHC QAADQMNSND VLSKDIDEGN  1260
LTSVAAEKIK SSDQLSMEID EGNLTPIAVS SDPLYCGSIV LSNNIVEKGS GCEGAVVPKQ  1320
SSKMQDGVMQ AVNRTRNSGL EAEAAPSSFR YPECLHHVPI EEDLVGVSVP QGDSNCHIEP  1380
ELPNPLVVQT NNMGWQFSEV NLDFDRRSQV LGHVKPEQNG QLHATSTESC QIPWISFTQD  1440
PSRIIRSKSD LIVKAQRTGE AFSLKKCTSS ATKPLTVFQK DGRSGHSRSH SFSLSDTKRL  1500
DKNGDVKLFG TVLTADENGS KQKHNPGGSI RPSSTLSRDH ETGHQYINQQ HLQNVPITSY  1560
GFWDGNRIQT GLTSLPESAK LVASYPEALT THQKQQVVST KEIQLDVSGI LSFGKQIEDR  1620
AEVSSGKDKG KIGGEVNGVA EAAT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4a69_C3e-17814904493NUCLEAR RECEPTOR COREPRESSOR 2
4a69_D3e-17814904493NUCLEAR RECEPTOR COREPRESSOR 2
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013604238.10.0PREDICTED: uncharacterized protein LOC106311574
TrEMBLA0A0D3DS760.0A0A0D3DS76_BRAOL; Uncharacterized protein
STRINGBra006915.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM52602744
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G52250.10.0MYB family protein